Biosafety and Biosecurity Challenges Facing Veterinary Diagnostic Laboratories in Lower-Middle Income Countries in Southeast Asia: A Case Study of Thailand

Biosafety and Biosecurity Challenges Facing Veterinary Diagnostic Laboratories in Lower-Middle Income Countries in Southeast Asia: A Case Study of Thailand

Introduction: Global issues over rising and transboundary infectious zoonotic ailments have elevated illness diagnostic calls for, particularly in the veterinary sector. In growing or newly developed nations the place the sector usually works beneath restricted capability, biosafety and biosecurity are unlikely to be high-priority points. A latest improvement program supported by the Biological Threat Reduction Program of the Defense Threat Reduction Agency funded by the US authorities aimed to extend biosafety and biosecurity measures of authorities veterinary diagnostic and analysis laboratories in Thailand.

Objective: The function of this text is to determine biosafety and biosecurity challenges, alternatives, and suggestions.

Methods: Eleven authorities laboratory facilities have been assessed towards the Biosafety in Microbiological and Biomedical Laboratories (BMBLbiosafety degree 2 (BSL-2) necessities guidelines. The BMBL evaluation outcomes have been then mixed with the outcomes of dialogue periods, and the outcomes of pre- and post-test questionnaires carried out throughout biosafety evaluation workshops and self-evaluation experiences utilizing the Food and Agriculture Organization Biosafety Laboratory Mapping Tool of every laboratory heart have been reviewed and summarized.

Results: Despite established nationwide insurance policies on laboratory biosafety and biosecurity, main challenges included (1) harmonization and enforcement of these insurance policies, particularly on the regional degree, and (2) engagement of personnel in implementations of biosafety and biosecurity measures.

Conclusion: Consistent biosafety coverage and allotted assets along with common coaching are required to develop sustainable biosafety and biosecurity on the nationwide degree. Collaboration between regional nations, worldwide organizations, and donors is crucial for bettering biosafety and biosecurity on a world scale by means of setting regional priorities, enacting regulatory requirements, and offering technical and monetary help.

 Biosafety and Biosecurity Challenges Facing Veterinary Diagnostic Laboratories in Lower-Middle Income Countries in Southeast Asia: A Case Study of Thailand
Biosafety and Biosecurity Challenges Facing Veterinary Diagnostic Laboratories in Lower-Middle Income Countries in Southeast Asia: A Case Study of Thailand

Lab-Scale Production of Recombinant Adeno-Associated Viruses (AAV) for Expression of Optogenetic Elements

Optogenetics, that’s, the use of photoswitchable/-activatable moieties to exactly management or monitor the exercise of cells and genes at unprecedented spatiotemporal decision, holds great promise for a wide selection of purposes in elementary and scientific analysis. To absolutely notice and harness this potential, the supply of gene switch autos (“vectors”) which can be simply produced and that permit to ship the important parts to desired goal cells in an environment friendly method is vital.

For in vivo purposes, it’s, furthermore, necessary that these vectors exhibit a excessive diploma of cell specificity in order to scale back the danger of adversarial uncomfortable side effects in off-targets and to reduce manufacturing prices. Here, we describe a set of fundamental protocols for the cloning, manufacturing, purification, and high quality management of a selected vector that may fulfill all these necessities, that’s, recombinant adeno-associated viruses (AAV).

The latter are very engaging owing to their apathogenicity, their compatibility with the bottom biosafety degree 1 circumstances, their incidence in a number of pure variants with distinct properties, and their distinctive amenability to engineering of the viral capsid and genome.

VEGFR-1 / FLT-1 Antibody

abx239393-100ug 100 ug
EUR 481

Human FLT-1/VEGFR-1 Control/blocking peptide #1

FLT11-P 100 ug
EUR 164

Anti-Flt-4 Antibody

A01276-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Flt-4 Antibody (FLT4) detection.tested for IHC, WB in Human, Mouse, Rat.

Rabbit Anti-human FLT-1/VEGFR-1 IgG #1, aff pure

FLT11-A 100 ul
EUR 482

Mouse FLT-4/VEGFR-3 Control/blocking peptide #1

FLT41-P 100 ug
EUR 164

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT12-M 100 ug
EUR 482

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT14-M 100 ug
EUR 482

VEGFR-2, human recombinant protein

P1080-.1 100 µg
EUR 1929
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity

Rabbit Anti-Mouse FLT-1/VEGFR-1 (279-299aa) IgG, aff pure

FLT15-A 100 ul
EUR 482

Human FLT-4/VEGFR-3 control/blocking peptide #2

FLT42-P 100 ug
EUR 164

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 280

Rabbit Anti-Mouse FLT-4/VEGFR-3 IgG #1, aff pure

FLT41-A 100 ug
EUR 482

VEGFR Tyrosine Kinase Inhibitor II

C4603-1 1 mg
EUR 118

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 276

Anti-Flt-1 antibody

STJ98080 100 µl
EUR 234
Description: Mouse monoclonal to Flt-1.

Anti-Flt-1 antibody

STJ93093 200 µl
EUR 197
Description: Rabbit polyclonal to Flt-1.

Anti-Flt-1 antibody

STJ93094 200 µl
EUR 197
Description: Rabbit polyclonal to Flt-1.

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 518

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

GnRH Associated Peptide (GAP) (1-13), human

A1020-1 1 mg
EUR 90
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

HIV-1 Tat Protein Peptide

B1433-1 1 mg
EUR 128
Description: HIV-1 Tat Protein Peptide

GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein

PROTP01275-1 Regular: 50ug
EUR 317
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.

Anti-PARP-1 Antibody

A00122-1 100ul
EUR 397
Description: Rabbit Polyclonal PARP-1 Antibody. Validated in ELISA, IP, IF, WB and tested in Human, Mouse.

Anti-Presenilin 1 Antibody

A00138-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Presenilin 1 Antibody (PSEN1) detection. Tested with WB, IHC in Human, Mouse, Rat.

Anti-PAI-1 Antibody

A00637-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for PAI-1 Antibody (SERPINE1) detection.tested for WB in Human, Mouse, Rat.

Anti-Flk-1 Antibody

A00901-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Flk-1 Antibody (KDR) detection.tested for WB in Human, Mouse.

Anti-EDG-1 Antibody

A01502-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for EDG-1 Antibody (S1PR1) detection.tested for WB in Human, Mouse, Rat.

Anti-ROBO-1 Antibody

A01530-1 100ug
EUR 455
Description: Rabbit Polyclonal ROBO-1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-TFIIIB90-1 Antibody

A03761-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TFIIIB90-1 Antibody (BRF1) detection.tested for WB in Human, Mouse.

Anti-Atrophin-1 Antibody

A03828-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Atrophin-1 Antibody (ATN1) detection. Tested with WB in Human, Mouse, Rat.

Anti-CNG-1 Antibody

A05494-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for CNG-1 Antibody (CNGA1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Periphilin 1 Antibody

A06996-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Periphilin 1 Antibody (PPHLN1) detection.tested for WB in Human, Mouse.

Anti-Lyl-1 Antibody

A07491-1 100ul
EUR 397
Description: Rabbit Polyclonal Lyl-1 Antibody. Validated in IHC and tested in Human, Mouse, Rat.

Anti-GLI-1 Antibody

A07972-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for GLI-1 Antibody (ACSS1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Cerebellin 1 Antibody

A09176-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Cerebellin 1 Antibody (CBLN1) detection. Tested with WB in Human, Mouse, Rat.

Anti-DOC-1 Antibody

A09467-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for DOC-1 Antibody (CDK2AP1) detection. Tested with WB in Human, Mouse.

Anti-Bag-1 Antibody

A02423-1 50 ul
EUR 397
Description: Rabbit Polyclonal Bag-1 Antibody. Validated in IP, IHC and tested in Bovine, Canine, Human, Mouse, Rat.

Anti-TUB 1 Antibody

A02917-1 100ug/vial
EUR 294

Anti-Dok-1 Antibody

A03039-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Dok-1 Antibody (DOK1) detection.tested for WB in Human, Mouse, Rat.

Anti-NPDC-1 Antibody

A12846-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for NPDC-1 Antibody (NPDC1) detection. Tested with WB in Human, Mouse, Rat.

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0001 1.0mg
EUR 576
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

VEGFR-KDR/Flk-1 Antagonist Peptide

H-5896.0005 5.0mg
EUR 2207
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net

YAP-TEAD Inhibitor 1 (Peptide 17)

A1149-1 1 mg
EUR 235

Rabbit Anti-Human FLT-4/VEGFR-3 IgG #2, aff pure

FLT42-A 100 ug
EUR 482

Anti-Apaf-1 (human) Monoclonal Antibody (2E12)

M00889-1 100ug
EUR 432
Description: Rat Monoclonal Apaf-1 (human) Antibody (2E12). Validated in ELISA, IP, IF, WB and tested in Human.

Anti-HO-1 Monoclonal Antibody (HO-1-2)

M00253-1 1mg
EUR 397
Description: Mouse Monoclonal HO-1 Antibody (HO-1-2). Validated in Flow Cytometry, IHC, WB and tested in Human, Mouse, Rat.

C-type natriuretic peptide (1-22) (human, rat, swine)

B5441-1 1 mg
EUR 276

Anti-Esrp-1 Monoclonal Antibody

M06068-1 100uL
EUR 443
Description: Mouse Monoclonal Esrp-1 Antibody. Validated in WB and tested in Human.

Anti-Presenilin 1 Monoclonal Antibody

M00138-1 100ug
EUR 397
Description: Rabbit Monoclonal Presenilin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Galectin 1 Monoclonal Antibody

M00470-1 100ug
EUR 397
Description: Rabbit Monoclonal Galectin 1 Antibody. Validated in IP, IF, WB and tested in Human, Mouse, Rat.

Anti-DJ-1 Monoclonal Antibody

M00757-1 100ul
EUR 397
Description: Mouse Monoclonal DJ-1 Antibody. Validated in IHC, WB and tested in Bovine, Human.

Anti-Enolase 1 Monoclonal Antibody

M01250-1 100ul
EUR 397
Description: Anti-Enolase 1 Monoclonal Antibody tested in WB, IF, ICC, IHC, reactive to Human, rat, mouse, cow, pig, horse

Anti-Dynamin 1 Monoclonal Antibody

M02536-1 100ug
EUR 397
Description: Rabbit Monoclonal Dynamin 1 Antibody. Validated in IF, WB and tested in Human, Mouse, Rat.

Anti-Angiopoietin 1/ANGPT1 Antibody

PA1333-1 100ug/vial
EUR 334

Anti-Galectin 1/LGALS1 Antibody

PB9240-1 100ug/vial
EUR 334

Anti-TNF Receptor 1 Antibody

A00294-1 200ug
EUR 522
Description: Rabbit Polyclonal TNF Receptor 1 Antibody. Validated in IP, IHC, WB and tested in Human, Mouse, Rat.

Anti-Galectin 1/Lgals1 Antibody

A00470-1 100ug/vial
EUR 334

Anti-LOX-1/OLR1 Antibody

A00760-1 100ug/vial
EUR 294

Anti-Syndecan-1/SDC1 Antibody

A00991-1 100ug/vial
EUR 294

Anti-IRAK-1/IRAK1 Antibody

A01021-1 100ug/vial
EUR 334

Anti-Neurexin 1/NRXN1 Antibody

A01490-1 100ug/vial
EUR 334

Anti-Hexokinase 1/HK1 Antibody

A01504-1 100ug/vial
EUR 334

Anti-Musashi 1/Msi1 Antibody

A05052-1 100ug/vial
EUR 334

Anti-Pyrophosphatase 1/PPA1 Antibody

A07485-1 100ug/vial
EUR 334

Anti-TCP-1 eta Antibody

A08169-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCP-1 eta Antibody (CCT7) detection. Tested with WB in Human, Mouse, Rat.

Anti-Relaxin 1/RLN1 Antibody

A08367-1 100ug/vial
EUR 334

Anti-TCP-1 zeta Antibody

A09373-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCP-1 zeta Antibody (CCT6A) detection.tested for WB in Human, Mouse, Rat.

Anti-Synaptotagmin 1/SYT1 Antibody

A02314-1 100ug/vial
EUR 334

Anti-Syntenin-1 Monoclonal Antibody

A02475-1 100ul
EUR 397
Description: Mouse Monoclonal Antibody for Syntenin-1 Antibody (SDCBP) detection. Tested with WB in Human, Rat, Dog, Pig.

Anti-Dsg1/Desmoglein 1 Antibody

A02655-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Dsg1 Antibody (DSG1) detection.tested for IHC, WB in Human, Mouse, Rat.

Anti-CAF-1 p150 Antibody

A02732-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for CAF-1 p150 Antibody (CHAF1A) detection. Tested with WB in Human, Mouse.

Anti-Talin 1/TLN1 Antibody

A02859-1 100ug/vial
EUR 334

Anti-Islet 1/ISL1 Antibody

A02969-1 100ug/vial
EUR 334

Anti-CHST8/Galnac4St 1 Antibody

A10989-1 100ul
EUR 397
Description: Rabbit Polyclonal CHST8/Galnac4St 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

VEGFR-1 Antibody

48347-100ul 100ul
EUR 333

VEGFR-1 Antibody

48347-50ul 50ul
EUR 239

Anti-P-glycoprotein (human) Monoclonal Antibody (JSB-1)

M00049-1 125ug
EUR 586
Description: Mouse Monoclonal P-glycoprotein (human) Antibody (JSB-1). Validated in IF and tested in Human.

Lytic Peptide, Shiva ? 1

SP-88327-1 1 mg
EUR 347

Anti-Peptide YY/PYY Antibody

A04223-1 100ug/vial
EUR 334

Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378

M04431-1 100uL
EUR 385
Description: Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378 tested in WB, IHC, reactive to Human

AXMIR-1 RNA oligo anti-miRNA-1-3p with Xmotif

AXMIR-1 10 reactions
EUR 438

Anti-Sumo 1 Rabbit Monoclonal Antibody

M00631-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Sumo 1 Antibody. Validated in IP, IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-Cytokeratin 1 Rabbit Monoclonal Antibody

M01639-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Cytokeratin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Mitofusin 1 Antibody (monoclonal, 3H3)

M02172-1 100ug/vial
EUR 294

Anti-Phospho-Beclin-1 (Ser295) Antibody

P00327-1 100ul
EUR 398
Description: Rabbit Polyclonal Phospho-Beclin-1 (Ser295) Antibody. Validated in WB and tested in Human.

Anti-Phospho-Raf-1 (Ser642) Antibody

P00446-1 100ul
EUR 398
Description: Rabbit Polyclonal Phospho-Raf-1 (Ser642) Antibody. Validated in WB and tested in Human, Rat.

Anti-Integrin alpha 1/ITGA1 Antibody

PA1045-1 100ug/vial
EUR 334

Anti-Caspase-1(P20)/CASP1 Antibody

PA1440-1 100ug/vial
EUR 294

Anti-VEGF Receptor 1/FLT1 Antibody

PA1966-1 100ug/vial
EUR 294

Anti-HIF-1 alpha/HIF1A Antibody

A00013-1 100ug/vial
EUR 294

Anti-Cleaved-Notch 1 (V1754) Antibody

A00033-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Cleaved-Notch 1 (V1754) Antibody (NOTCH1) detection.tested for WB in Human, Mouse, Rat.

Anti-HDAC-1 (C-terminus) Antibody

A00256-1 100uL
EUR 443
Description: Rabbit Polyclonal HDAC-1 (C-terminus) Antibody. Validated in IF, IHC, WB and tested in Human.

Anti-VEGF Receptor 1/FLT1 Antibody

A00534-1 100ug/vial
EUR 294

Anti-Liver Carboxylesterase 1/CES1 Antibody

A01741-1 100ug/vial
EUR 334

Anti-Hyaluronan synthase 1/HAS1 Antibody

A04784-1 100ug/vial
EUR 334

Anti-CELSR3/Flamingo Homolog 1 Antibody

A07204-1 100ul
EUR 397
Description: Rabbit Polyclonal CELSR3/Flamingo Homolog 1 Antibody. Validated in IF and tested in Human, Mouse, Rat.

Anti-LPCAT2/Acyltransferase Like 1 Antibody

A07471-1 100ul
EUR 397
Description: Rabbit Polyclonal LPCAT2/Acyltransferase Like 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-EBP50/NHERF-1/SLC9A3R1 Antibody

A02427-1 100ug/vial
EUR 334

Anti-IL1R2/Il 1 Rii Antibody

A03106-1 1 ml
EUR 397
Description: Rabbit Polyclonal IL1R2/Il 1 Rii Antibody. Validated in IP, WB and tested in Human.


DB-089-1 1 ml
EUR 750
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-HLA-G (human) Monoclonal Antibody (MEM-G/1)

M01235-1 100ug
EUR 397
Description: Mouse Monoclonal HLA-G (human) Antibody (MEM-G/1). Validated in IHC, WB and tested in Human.

VEGFR-1/Flt1/ Rat VEGFR- 1/ Flt1 ELISA Kit

ELA-E0147r 96 Tests
EUR 886

Anti-Phospho-Flt-1 (Y1048) antibody

STJ91223 200 µl
EUR 197
Description: Rabbit polyclonal to Phospho-Flt-1 (Y1048).

Anti-Phospho-Flt-1 (Y1213) antibody

STJ91359 200 µl
EUR 197
Description: Rabbit polyclonal to Phospho-Flt-1 (Y1213).

Anti-Flk-1/Flt-4 antibody

STJ93091 200 µl
EUR 197
Description: Rabbit polyclonal to Flk-1/Flt-4.

Anti-Phospho-Flt-1 (Y1333) antibody

STJ90838 200 µl
EUR 197
Description: Rabbit polyclonal to Phospho-Flt-1 (Y1333).

Endothelin-1 (1-15), amide, human

A1111-1 1 mg
EUR 722
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.

Haptoglobin, (Phenotype 1-1) Human Plasma

EUR 321

Mouse FLK-1/VEGFR-2 control/blocking peptide # 1

FLK11-P 100 ug
EUR 164

Human/Rat/Mouse PLP104-117 peptide, depalmitoylated

PLP104-1-1 1 mg
EUR 141

Human/Rat/Mouse PLP178-191 peptide, depalmitoylated

PLP178-1-1 1 mg
EUR 141

Human/Rat/Mouse PLP40-59 peptide, depalmitoylated

PLP40-1-1 1 mg
EUR 141

Hemokinin 1 (human)

B5318-1 1 mg
EUR 340

Anti-Musashi 1/Msi1 Antibody (monoclonal, 2B9)

M05052-1 100ug/vial
EUR 334

Anti-Visinin-like Protein 1 Monoclonal Antibody

M06959-1 100ul
EUR 397
Description: Mouse Monoclonal Visinin-like Protein 1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-HMGB1/Hmg 1 Rabbit Monoclonal Antibody

M00066-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal HMGB1/Hmg 1 Antibody. Validated in Flow Cytometry, IF, IHC, ICC, WB and tested in Human, Mouse, Rat.

Anti-p27 KIP 1 Rabbit Monoclonal Antibody

M00173-1 100ug/vial
EUR 397
Description: Anti-p27 KIP 1 Rabbit Monoclonal Antibody tested for Flow Cytometry, IP, IF, IHC, ICC, WB in Human, Rat

Anti-Caveolin-1/CAV1 Antibody (monoclonal, 12C7)

M00179-1 100ug/vial
EUR 334

Anti-MHC class 1 Rabbit Monoclonal Antibody

M00194-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal MHC class 1 Antibody. Validated in IP, IF, IHC, WB and tested in Human.

Anti-Integrin beta 1 Rabbit Monoclonal Antibody

M00772-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Integrin beta 1 Antibody. Validated in IHC, WB and tested in Human, Mouse, Rat.

Anti-ARG1/Arginase 1 Rabbit Monoclonal Antibody

M01106-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal ARG1/Arginase 1 Antibody. Validated in IP, WB and tested in Human, Mouse, Rat.

Anti-MLANA/Mart 1 Rabbit Monoclonal Antibody

M02033-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal MLANA/Mart 1 Antibody. Validated in IF, WB and tested in Human.

Anti-TCP-1α Monoclonal Antibody (91a)

M02389-1 200ug
EUR 498
Description: Rat Monoclonal TCP-1α Antibody (91a). Validated in Flow Cytometry, IP, IF, WB and tested in Human, Mouse, Rat.

Anti-DSG1/Desmoglein 1 Rabbit Monoclonal Antibody

M02655-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal DSG1/Desmoglein 1 Antibody. Validated in IF, IHC, ICC, WB and tested in Human, Mouse, Rat.

Anti-Phospho-Glycogen Synthase 1 (S645) Antibody

P03512-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Phospho-Glycogen Synthase 1 (S645) Antibody (GYS1) detection.tested for WB in Human, Mouse, Rat.

Anti-Angiotensin Converting Enzyme 1/ACE Antibody

PA2196-1 100ug/vial
EUR 334

Anti-GABA B Receptor 1/GABBR1 Antibody

A07297-1 100ug/vial
EUR 294

Anti-Vangl1/Vang Like Protein 1 Antibody

A07587-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Vangl1 Antibody (VANGL1) detection. Tested with WB in Human, Mouse.

Anti-E74 like factor 1/ELF1 Antibody

A03187-1 100ug/vial
EUR 294

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein

P1054-1 1 mg
EUR 3947
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

Human/Rat/Mouse PLP139-151 (S140) peptide, depalmitoylated

PLP139-1-1 1 mg
EUR 141

miRZip-1 anti-miR-1 microRNA construct

MZIP1-PA-1 Bacterial Streak
EUR 684


DB-060-1 1 ml
EUR 750
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated


DB-061-1 1 ml
EUR 750
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein

PROTP03956-1 Regular: 20ug
EUR 317
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.

Anti-AFP/Alpha 1 Fetoprotein Rabbit Monoclonal Antibody

M00522-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal AFP/Alpha 1 Fetoprotein Antibody. Validated in IP, IF, WB and tested in Human.

Anti-SERPINA1/Alpha 1 Antitrypsin Rabbit Monoclonal Antibody

M00720-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal SERPINA1/Alpha 1 Antitrypsin Antibody. Validated in IP, IF, WB and tested in Human.

Anti-GPX1/Glutathione Peroxidase 1 Rabbit Monoclonal Antibody

M01019-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal GPX1/Glutathione Peroxidase 1 Antibody. Validated in IP, WB and tested in Human, Mouse, Rat.

Anti-BAG-1 Rabbit Monoclonal Antibody, Clone#RM356

M02423-1 100uL
EUR 385
Description: Anti-BAG-1 Rabbit Monoclonal Antibody, Clone#RM356 tested in WB, IHC, reactive to Human

Anti-Mitochondrial Pyruvate dehydrogenase kinase 1/PDK1 Antibody

A01268-1 100ug/vial
EUR 334

XStamp Pro anti-PD-1 EV Targeting Kit

XSTP915A-1 10 rxn
EUR 805

IGF-1, human recombinant

P1016-.1 100 µg
EUR 763
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue

BNP (1-32), human

A1105-1 1 mg
EUR 177
Description: Basic natriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP) or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

Atrial Natriuretic Peptide (1-28), Rat

SP-55278-1 0.5 mg
EUR 286

(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein

PROTO75771-1 Regular: 10ug
EUR 317
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

IL1RL1 Human, Interleukin-1 Receptor Like-1 Human Recombinant Protein, Sf9

PROTQ01638-1 Regular: 10ug
EUR 317
Description: IL 1RL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (19-328 a.a.) and fused to an 8 aa His Tag at C-terminus containing a total of 318 amino acids and having a molecular mass of 36.0kDa.;IL 1RL1 shows multiple bands between 40-57kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.

Anti-Phospho-AMPK alpha 1 (S496) Rabbit Monoclonal Antibody

P00994-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Phospho-AMPK alpha 1 (S496) Antibody. Validated in IP, IF, WB and tested in Human.

CF350 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20245-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF488A Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20246-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF555 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20247-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF568 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20248-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF594 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20249-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF633 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20250-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF640R Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20251-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF647 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20252-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF680 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20253-1 50uL
EUR 161
Description: Minimum order quantity: 1 unit of 50uL

CF770 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20254-1 50uL
EUR 161
Description: Minimum order quantity: 1 unit of 50uL

CF543 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

20325-1 50uL
EUR 149
Description: Minimum order quantity: 1 unit of 50uL

Flt-1 Polyclonal Antibody

ES5317-50ul 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Flt-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Flt-1 Polyclonal Antibody

ES5318-100ul 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Flt-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Flt-1 Polyclonal Antibody

ES5317-100ul 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Flt-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Flt-1 Polyclonal Antibody

ES5318-50ul 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Flt-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Flt-1 Polyclonal Antibody

ABP54318-003ml 0.03ml
EUR 158
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1048

Flt-1 Polyclonal Antibody

ABP54318-01ml 0.1ml
EUR 289
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1048

Flt-1 Polyclonal Antibody

ABP54318-02ml 0.2ml
EUR 414
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1048

Flt-1 Polyclonal Antibody

ABP54319-003ml 0.03ml
EUR 158
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1333

Flt-1 Polyclonal Antibody

ABP54319-01ml 0.1ml
EUR 289
Description: A polyclonal antibody for detection of Flt-1 from Human, Mouse, Rat. This Flt-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Flt-1 around the non-phosphorylation site of Y1333

The particular procedures reported right here complement various protocols for AAV manufacturing described by others and us earlier than, and, collectively, ought to allow any laboratory to generate these vectors on a small-to-medium scale for ex vivo or in vivo expression of optogenetic parts.

Leave A Comment