Biosafety and Biosecurity Challenges Facing Veterinary Diagnostic Laboratories in Lower-Middle Income Countries in Southeast Asia: A Case Study of Thailand

Introduction: Global issues over rising and transboundary infectious zoonotic ailments have elevated illness diagnostic calls for, particularly in the veterinary sector. In growing or newly developed nations the place the sector usually works beneath restricted capability, biosafety and biosecurity are unlikely to be high-priority points. A latest improvement program supported by the Biological Threat Reduction Program of the Defense Threat Reduction Agency funded by the US authorities aimed to extend biosafety and biosecurity measures of authorities veterinary diagnostic and analysis laboratories in Thailand.
Objective: The function of this text is to determine biosafety and biosecurity challenges, alternatives, and suggestions.
Methods: Eleven authorities laboratory facilities have been assessed towards the Biosafety in Microbiological and Biomedical Laboratories (BMBL) biosafety degree 2 (BSL-2) necessities guidelines. The BMBL evaluation outcomes have been then mixed with the outcomes of dialogue periods, and the outcomes of pre- and post-test questionnaires carried out throughout biosafety evaluation workshops and self-evaluation experiences utilizing the Food and Agriculture Organization Biosafety Laboratory Mapping Tool of every laboratory heart have been reviewed and summarized.
Results: Despite established nationwide insurance policies on laboratory biosafety and biosecurity, main challenges included (1) harmonization and enforcement of these insurance policies, particularly on the regional degree, and (2) engagement of personnel in implementations of biosafety and biosecurity measures.
Conclusion: Consistent biosafety coverage and allotted assets along with common coaching are required to develop sustainable biosafety and biosecurity on the nationwide degree. Collaboration between regional nations, worldwide organizations, and donors is crucial for bettering biosafety and biosecurity on a world scale by means of setting regional priorities, enacting regulatory requirements, and offering technical and monetary help.

Lab-Scale Production of Recombinant Adeno-Associated Viruses (AAV) for Expression of Optogenetic Elements
Optogenetics, that’s, the use of photoswitchable/-activatable moieties to exactly management or monitor the exercise of cells and genes at unprecedented spatiotemporal decision, holds great promise for a wide selection of purposes in elementary and scientific analysis. To absolutely notice and harness this potential, the supply of gene switch autos (“vectors”) which can be simply produced and that permit to ship the important parts to desired goal cells in an environment friendly method is vital.
For in vivo purposes, it’s, furthermore, necessary that these vectors exhibit a excessive diploma of cell specificity in order to scale back the danger of adversarial uncomfortable side effects in off-targets and to reduce manufacturing prices. Here, we describe a set of fundamental protocols for the cloning, manufacturing, purification, and high quality management of a selected vector that may fulfill all these necessities, that’s, recombinant adeno-associated viruses (AAV).
The latter are very engaging owing to their apathogenicity, their compatibility with the bottom biosafety degree 1 circumstances, their incidence in a number of pure variants with distinct properties, and their distinctive amenability to engineering of the viral capsid and genome.
Human FLT-1/VEGFR-1 Control/blocking peptide #1 |
|||
FLT11-P | Alpha Diagnostics | 100 ug | EUR 196.8 |
VEGFR-1 / FLT-1 Antibody |
|||
abx239393-100ug | Abbexa | 100 ug | EUR 577.2 |
Anti-Flt-4 Antibody |
|||
A01276-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Flt-4 Antibody (FLT4) detection.tested for IHC, WB in Human, Mouse, Rat. |
Mouse FLT-4/VEGFR-3 Control/blocking peptide #1 |
|||
FLT41-P | Alpha Diagnostics | 100 ug | EUR 196.8 |
Rabbit Anti-human FLT-1/VEGFR-1 IgG #1, aff pure |
|||
FLT11-A | Alpha Diagnostics | 100 ul | EUR 578.4 |
HRP-Goat Anti-Mouse Secondary Antibody |
|||
A12003 | EpiGentek |
|
|
HRP-Goat Anti-Rabbit Secondary Antibody |
|||
A12004 | EpiGentek |
|
|
Goat Anti-Rabbit Secondary Antibody, Biotin Conjugated |
|||
A12001 | EpiGentek |
|
|
Goat Anti-Rat Secondary Antibody, Biotin Conjugated |
|||
A12002 | EpiGentek |
|
|
Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure |
|||
FLT12-M | Alpha Diagnostics | 100 ug | EUR 578.4 |
Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure |
|||
FLT14-M | Alpha Diagnostics | 100 ug | EUR 578.4 |
VEGFR-2, human recombinant protein |
|||
P1080-.1 | ApexBio | 100 µg | EUR 2314.8 |
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity |
Human Genomic DNA |
|||
X11000 | EpiGentek |
|
|
Human Brain Genomic DNA |
|||
X11001 | EpiGentek |
|
|
Human FLT-4/VEGFR-3 control/blocking peptide #2 |
|||
FLT42-P | Alpha Diagnostics | 100 ug | EUR 196.8 |
Amyloid ?-Peptide (1-42) (human) |
|||
B6057-.1 | ApexBio | 100 ug | EUR 331.2 |
Rabbit Anti-Mouse FLT-1/VEGFR-1 (279-299aa) IgG, aff pure |
|||
FLT15-A | Alpha Diagnostics | 100 ul | EUR 578.4 |
VEGFR Tyrosine Kinase Inhibitor II |
|||
C4603-1 | ApexBio | 1 mg | EUR 141.6 |
Polyclonal Goat anti-GST α-form |
|||
GST-ANTI-1 | Detroit R&D | 50 uL | EUR 336 |
Histone H3 Methylation Antibody Panel Pack I – Active Genes |
|||
C10000 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack I – Repression Genes |
|||
C10001 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack II – Active Genes |
|||
C10002 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack II – Repression Genes |
|||
C10003 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack III – Active Genes |
|||
C10004 | EpiGentek |
|
|
Histone H3K4 Methylation Antibody Panel Pack |
|||
C10005 | EpiGentek |
|
|
Histone H3K9 Methylation Antibody Panel Pack |
|||
C10006 | EpiGentek |
|
|
Histone H3K27 Methylation Antibody Panel Pack |
|||
C10007 | EpiGentek |
|
|
Histone H3K36 Methylation Antibody Panel Pack |
|||
C10008 | EpiGentek |
|
|
Histone H3K79 Methylation Antibody Panel Pack |
|||
C10009 | EpiGentek |
|
|
Histone H3 Acetylation Antibody Panel Pack I |
|||
C10010 | EpiGentek |
|
|
Histone H3 Acetylation Antibody Panel Pack II |
|||
C10011 | EpiGentek |
|
|
Histone H4K20 Methylation Antibody Panel Pack |
|||
C10012 | EpiGentek |
|
|
Histone H4 Acetylation Antibody Panel Pack |
|||
C10013 | EpiGentek |
|
|
Histone H3 Phosphorylation Antibody Panel Pack |
|||
C10014 | EpiGentek |
|
|
Histone H3R2 Methylation Antibody Panel Pack |
|||
C10015 | EpiGentek |
|
|
Histone H3R8 Methylation Antibody Panel Pack |
|||
C10016 | EpiGentek |
|
|
Histone H3R17 Methylation Antibody Panel Pack |
|||
C10017 | EpiGentek |
|
|
Histone H3R26 Methylation Antibody Panel Pack |
|||
C10018 | EpiGentek |
|
|
Histone H4R3 Methylation Antibody Panel Pack |
|||
C10019 | EpiGentek |
|
|
DNA Methylation Antibody Panel Pack I |
|||
C20000 | EpiGentek |
|
|
DNMT3A Protein |
|||
E11000 | EpiGentek |
|
|
TET1 Protein (Active) |
|||
E12002 | EpiGentek |
|
|
DNMT3B Protein |
|||
E14000 | EpiGentek |
|
|
DNMT1 Protein |
|||
E15000 | EpiGentek |
|
|
HDAC1 Protein |
|||
E24002 | EpiGentek |
|
|
HDAC10 Protein |
|||
E24003 | EpiGentek |
|
|
HDAC11 Protein |
|||
E24004 | EpiGentek |
|
|
HDAC2 Protein |
|||
E24005 | EpiGentek |
|
|
HDAC3 Protein |
|||
E24006 | EpiGentek |
|
|
HDAC4 Protein |
|||
E24007 | EpiGentek |
|
|
HDAC5 Protein |
|||
E24008 | EpiGentek |
|
|
HDAC6 Protein |
|||
E24009 | EpiGentek |
|
|
HDAC7 Protein |
|||
E24010 | EpiGentek |
|
|
HDAC8 Protein |
|||
E24011 | EpiGentek |
|
|
HDAC9 Protein |
|||
E24012 | EpiGentek |
|
|
H3F3A Protein |
|||
E35003 | EpiGentek |
|
|
H4 Protein |
|||
E35005 | EpiGentek |
|
|
SOD1 Protein |
|||
E70000 | EpiGentek |
|
|
EpiMag HT (96-Well) Magnetic Separator |
|||
Q10002 | EpiGentek |
|
|
EpiMag 96-Well Microplate (5/pack) |
|||
Q10003 | EpiGentek |
|
|
Rabbit Anti-Mouse FLT-4/VEGFR-3 IgG #1, aff pure |
|||
FLT41-A | Alpha Diagnostics | 100 ug | EUR 578.4 |
Amyloid Beta-Peptide (1-40) (human) |
|||
A1124-1 | ApexBio | 1 mg | EUR 226.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Brain natriuretic peptide (1-32) (human) |
|||
B5442-1 | ApexBio | 1 mg | EUR 621.6 |
SARS-CoV-2 Spike S1 RBD Protein, Human Fc-Fusion, Avi-Tag |
|||
E80025 | EpiGentek |
|
|
GnRH Associated Peptide (GAP) (1-13), human |
|||
A1020-1 | ApexBio | 1 mg | EUR 108 |
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP). |
HIV-1 Tat Protein Peptide |
|||
B1433-1 | ApexBio | 1 mg | EUR 153.6 |
Description: HIV-1 Tat Protein Peptide |
GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein |
|||
PROTP01275-1 | BosterBio | Regular: 50ug | EUR 380.4 |
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques. |
Anti-Flt-1 antibody |
|||
STJ93093 | St John's Laboratory | 200 µl | EUR 236.4 |
Description: Rabbit polyclonal to Flt-1. |
Anti-Flt-1 antibody |
|||
STJ93094 | St John's Laboratory | 200 µl | EUR 236.4 |
Description: Rabbit polyclonal to Flt-1. |
Anti-Flt-1 antibody |
|||
STJ98080 | St John's Laboratory | 100 µl | EUR 280.8 |
Description: Mouse monoclonal to Flt-1. |
ACE2, His-Tag Protein |
|||
E80019 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 (13-665) Protein, Fc Fusion, Avi-tag |
|||
E80020 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 (16-685) Protein, Avi-His-tag |
|||
E80021 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 (16-685) Protein, Fc Fusion, Avi-tag |
|||
E80022 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 RBD (V367F) Protein, Avi-His-tag |
|||
E80023 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 RBD Protein, Avi-His-tag |
|||
E80024 | EpiGentek |
|
|
SARS-CoV-2 Spike S1 RBD Protein, Mouse Fc-fusion |
|||
E80026 | EpiGentek |
|
|
SARS-CoV-2 Nucleocapsid Protein, Avi-His-tag |
|||
E80027 | EpiGentek |
|
|
Recombinant SARS-CoV-2 Spike Glycoprotein(S) (D614G), Partial |
|||
E80028 | EpiGentek |
|
|
VEGFR-KDR/Flk-1 Antagonist Peptide |
|||
H-5896.0001 | Bachem | 1.0mg | EUR 691.2 |
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net |
VEGFR-KDR/Flk-1 Antagonist Peptide |
|||
H-5896.0005 | Bachem | 5.0mg | EUR 2648.4 |
Description: Sum Formula: C77H99N23O18S; CAS# [492444-99-2] net |
YAP-TEAD Inhibitor 1 (Peptide 17) |
|||
A1149-1 | ApexBio | 1 mg | EUR 282 |
C-type natriuretic peptide (1-22) (human, rat, swine) |
|||
B5441-1 | ApexBio | 1 mg | EUR 331.2 |
Rabbit Anti-Human FLT-4/VEGFR-3 IgG #2, aff pure |
|||
FLT42-A | Alpha Diagnostics | 100 ug | EUR 578.4 |
Lytic Peptide, Shiva ? 1 |
|||
SP-88327-1 | Alpha Diagnostics | 1 mg | EUR 416.4 |
Anti-Periphilin 1 Antibody |
|||
A06996-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Periphilin 1 Antibody (PPHLN1) detection.tested for WB in Human, Mouse. |
Anti-Lyl-1 Antibody |
|||
A07491-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Lyl-1 Antibody. Validated in IHC and tested in Human, Mouse, Rat. |
Anti-GLI-1 Antibody |
|||
A07972-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for GLI-1 Antibody (ACSS1) detection. Tested with WB in Human, Mouse, Rat. |
Anti-Cerebellin 1 Antibody |
|||
A09176-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Cerebellin 1 Antibody (CBLN1) detection. Tested with WB in Human, Mouse, Rat. |
Anti-DOC-1 Antibody |
|||
A09467-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for DOC-1 Antibody (CDK2AP1) detection. Tested with WB in Human, Mouse. |
Anti-NPDC-1 Antibody |
|||
A12846-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for NPDC-1 Antibody (NPDC1) detection. Tested with WB in Human, Mouse, Rat. |
Anti-ROBO-1 Antibody |
|||
A01530-1 | BosterBio | 100ug | EUR 546 |
Description: Rabbit Polyclonal ROBO-1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat. |
Anti-Bag-1 Antibody |
|||
A02423-1 | BosterBio | 50 ul | EUR 476.4 |
Description: Rabbit Polyclonal Bag-1 Antibody. Validated in IP, IHC and tested in Bovine, Canine, Human, Mouse, Rat. |
Anti-TUB 1 Antibody |
|||
A02917-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-Dok-1 Antibody |
|||
A03039-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Dok-1 Antibody (DOK1) detection.tested for WB in Human, Mouse, Rat. |
Anti-TFIIIB90-1 Antibody |
|||
A03761-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for TFIIIB90-1 Antibody (BRF1) detection.tested for WB in Human, Mouse. |
Anti-Atrophin-1 Antibody |
|||
A03828-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Atrophin-1 Antibody (ATN1) detection. Tested with WB in Human, Mouse, Rat. |
Anti-CNG-1 Antibody |
|||
A05494-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for CNG-1 Antibody (CNGA1) detection. Tested with WB in Human, Mouse, Rat. |
Anti-PAI-1 Antibody |
|||
A00637-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for PAI-1 Antibody (SERPINE1) detection.tested for WB in Human, Mouse, Rat. |
Anti-Flk-1 Antibody |
|||
A00901-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Flk-1 Antibody (KDR) detection.tested for WB in Human, Mouse. |
Anti-EDG-1 Antibody |
|||
A01502-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for EDG-1 Antibody (S1PR1) detection.tested for WB in Human, Mouse, Rat. |
Anti-PARP-1 Antibody |
|||
A00122-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal PARP-1 Antibody. Validated in ELISA, IP, IF, WB and tested in Human, Mouse. |
Anti-Presenilin 1 Antibody |
|||
A00138-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Presenilin 1 Antibody (PSEN1) detection. Tested with WB, IHC in Human, Mouse, Rat. |
Anti-Apaf-1 (human) Monoclonal Antibody (2E12) |
|||
M00889-1 | BosterBio | 100ug | EUR 518.4 |
Description: Rat Monoclonal Apaf-1 (human) Antibody (2E12). Validated in ELISA, IP, IF, WB and tested in Human. |
Anti-Peptide YY/PYY Antibody |
|||
A04223-1 | BosterBio | 100ug/vial | EUR 400.8 |
Methylamp 96 DNA Modification Kit |
|||
P-1008 | EpiGentek |
|
|
Nucleic Acid Isolation Enhancer (Glycogen Solution) |
|||
R-1001 | EpiGentek |
|
|
Methylamp PCR Enhancer |
|||
R-1002 | EpiGentek |
|
|
Streptavidin: HRP Conjugate |
|||
R-1098 | EpiGentek |
|
|
Streptavidin |
|||
R-1100 | EpiGentek |
|
|
Protease Inhibitor Cocktail |
|||
R-1101 | EpiGentek |
|
|
Streptavidin-Coated Strip Microwell Plate (Flat) |
|||
R-1102 | EpiGentek |
|
|
DNA High Binding Solution |
|||
R-1103 | EpiGentek |
|
|
DTT Solution |
|||
R-1104 | EpiGentek |
|
|
EpiQuik Nuclear Extraction Kit |
|||
OP-0002 | EpiGentek |
|
|
VEGFR-1 Antibody |
|||
48347-100ul | SAB | 100ul | EUR 399.6 |
VEGFR-1 Antibody |
|||
48347-50ul | SAB | 50ul | EUR 286.8 |
Human/Rat/Mouse PLP104-117 peptide, depalmitoylated |
|||
PLP104-1-1 | Alpha Diagnostics | 1 mg | EUR 169.2 |
Human/Rat/Mouse PLP178-191 peptide, depalmitoylated |
|||
PLP178-1-1 | Alpha Diagnostics | 1 mg | EUR 169.2 |
Human/Rat/Mouse PLP40-59 peptide, depalmitoylated |
|||
PLP40-1-1 | Alpha Diagnostics | 1 mg | EUR 169.2 |
Anti-HO-1 Monoclonal Antibody (HO-1-2) |
|||
M00253-1 | BosterBio | 1mg | EUR 476.4 |
Description: Mouse Monoclonal HO-1 Antibody (HO-1-2). Validated in Flow Cytometry, IHC, WB and tested in Human, Mouse, Rat. |
Anti-Pyrophosphatase 1/PPA1 Antibody |
|||
A07485-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-TCP-1 eta Antibody |
|||
A08169-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for TCP-1 eta Antibody (CCT7) detection. Tested with WB in Human, Mouse, Rat. |
Anti-Relaxin 1/RLN1 Antibody |
|||
A08367-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-TCP-1 zeta Antibody |
|||
A09373-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for TCP-1 zeta Antibody (CCT6A) detection.tested for WB in Human, Mouse, Rat. |
Anti-CHST8/Galnac4St 1 Antibody |
|||
A10989-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal CHST8/Galnac4St 1 Antibody. Validated in WB and tested in Human, Mouse, Rat. |
Anti-Synaptotagmin 1/SYT1 Antibody |
|||
A02314-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Syntenin-1 Monoclonal Antibody |
|||
A02475-1 | BosterBio | 100ul | EUR 476.4 |
Description: Mouse Monoclonal Antibody for Syntenin-1 Antibody (SDCBP) detection. Tested with WB in Human, Rat, Dog, Pig. |
Anti-Dsg1/Desmoglein 1 Antibody |
|||
A02655-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Dsg1 Antibody (DSG1) detection.tested for IHC, WB in Human, Mouse, Rat. |
Anti-CAF-1 p150 Antibody |
|||
A02732-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for CAF-1 p150 Antibody (CHAF1A) detection. Tested with WB in Human, Mouse. |
Anti-Talin 1/TLN1 Antibody |
|||
A02859-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Islet 1/ISL1 Antibody |
|||
A02969-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Musashi 1/Msi1 Antibody |
|||
A05052-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Galectin 1/Lgals1 Antibody |
|||
A00470-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-LOX-1/OLR1 Antibody |
|||
A00760-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-Syndecan-1/SDC1 Antibody |
|||
A00991-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-IRAK-1/IRAK1 Antibody |
|||
A01021-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Neurexin 1/NRXN1 Antibody |
|||
A01490-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Hexokinase 1/HK1 Antibody |
|||
A01504-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-TNF Receptor 1 Antibody |
|||
A00294-1 | BosterBio | 200ug | EUR 626.4 |
Description: Rabbit Polyclonal TNF Receptor 1 Antibody. Validated in IP, IHC, WB and tested in Human, Mouse, Rat. |
Anti-DJ-1 Monoclonal Antibody |
|||
M00757-1 | BosterBio | 100ul | EUR 476.4 |
Description: Mouse Monoclonal DJ-1 Antibody. Validated in IHC, WB and tested in Bovine, Human. |
Anti-Enolase 1 Monoclonal Antibody |
|||
M01250-1 | BosterBio | 100ul | EUR 476.4 |
Description: Anti-Enolase 1 Monoclonal Antibody tested in WB, IF, ICC, IHC, reactive to Human, rat, mouse, cow, pig, horse |
Anti-Dynamin 1 Monoclonal Antibody |
|||
M02536-1 | BosterBio | 100ug | EUR 476.4 |
Description: Rabbit Monoclonal Dynamin 1 Antibody. Validated in IF, WB and tested in Human, Mouse, Rat. |
Anti-Esrp-1 Monoclonal Antibody |
|||
M06068-1 | BosterBio | 100uL | EUR 531.6 |
Description: Mouse Monoclonal Esrp-1 Antibody. Validated in WB and tested in Human. |
Anti-Angiopoietin 1/ANGPT1 Antibody |
|||
PA1333-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-Presenilin 1 Monoclonal Antibody |
|||
M00138-1 | BosterBio | 100ug | EUR 476.4 |
Description: Rabbit Monoclonal Presenilin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat. |
Anti-Galectin 1 Monoclonal Antibody |
|||
M00470-1 | BosterBio | 100ug | EUR 476.4 |
Description: Rabbit Monoclonal Galectin 1 Antibody. Validated in IP, IF, WB and tested in Human, Mouse, Rat. |
Anti-Galectin 1/LGALS1 Antibody |
|||
PB9240-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-P-glycoprotein (human) Monoclonal Antibody (JSB-1) |
|||
M00049-1 | BosterBio | 125ug | EUR 703.2 |
Description: Mouse Monoclonal P-glycoprotein (human) Antibody (JSB-1). Validated in IF and tested in Human. |
Human/Rat/Mouse PLP139-151 (S140) peptide, depalmitoylated |
|||
PLP139-1-1 | Alpha Diagnostics | 1 mg | EUR 169.2 |
Mouse FLK-1/VEGFR-2 control/blocking peptide # 1 |
|||
FLK11-P | Alpha Diagnostics | 100 ug | EUR 196.8 |
Human Vascuar endothelial cell growth factor receptor 3, VEGFR-3/Flt-4 ELISA Kit |
|||
1-CSB-E04765h | Cusabio |
|
|
Description: Quantitative sandwich ELISA kit for measuring Human Vascuar endothelial cell growth factor receptor 3, VEGFR-3/Flt-4 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
VEGFR-1/Flt1/ Rat VEGFR- 1/ Flt1 ELISA Kit |
|||
ELA-E0147r | Lifescience Market | 96 Tests | EUR 1063.2 |
Haptoglobin, (Phenotype 1-1) Human Plasma |
|||
7536-1 | Biovision | EUR 385.2 |
Endothelin-1 (1-15), amide, human |
|||
A1111-1 | ApexBio | 1 mg | EUR 866.4 |
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis. |
Anti-HLA-G (human) Monoclonal Antibody (MEM-G/1) |
|||
M01235-1 | BosterBio | 100ug | EUR 476.4 |
Description: Mouse Monoclonal HLA-G (human) Antibody (MEM-G/1). Validated in IHC, WB and tested in Human. |
AXMIR-1 RNA oligo anti-miRNA-1-3p with Xmotif |
|||
AXMIR-1 | SBI | 10 reactions | EUR 525.6 |
Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378 |
|||
M04431-1 | BosterBio | 100uL | EUR 462 |
Description: Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378 tested in WB, IHC, reactive to Human |
Anti-CELSR3/Flamingo Homolog 1 Antibody |
|||
A07204-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal CELSR3/Flamingo Homolog 1 Antibody. Validated in IF and tested in Human, Mouse, Rat. |
Anti-LPCAT2/Acyltransferase Like 1 Antibody |
|||
A07471-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal LPCAT2/Acyltransferase Like 1 Antibody. Validated in WB and tested in Human, Mouse, Rat. |
Anti-Liver Carboxylesterase 1/CES1 Antibody |
|||
A01741-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-EBP50/NHERF-1/SLC9A3R1 Antibody |
|||
A02427-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-IL1R2/Il 1 Rii Antibody |
|||
A03106-1 | BosterBio | 1 ml | EUR 476.4 |
Description: Rabbit Polyclonal IL1R2/Il 1 Rii Antibody. Validated in IP, WB and tested in Human. |
Anti-Hyaluronan synthase 1/HAS1 Antibody |
|||
A04784-1 | BosterBio | 100ug/vial | EUR 400.8 |
Anti-VEGF Receptor 1/FLT1 Antibody |
|||
A00534-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-HIF-1 alpha/HIF1A Antibody |
|||
A00013-1 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-Cleaved-Notch 1 (V1754) Antibody |
|||
A00033-1 | BosterBio | 100ul | EUR 476.4 |
Description: Rabbit Polyclonal Antibody for Cleaved-Notch 1 (V1754) Antibody (NOTCH1) detection.tested for WB in Human, Mouse, Rat. |
The particular procedures reported right here complement various protocols for AAV manufacturing described by others and us earlier than, and, collectively, ought to allow any laboratory to generate these vectors on a small-to-medium scale for ex vivo or in vivo expression of optogenetic parts.